GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: CCRIS 3307 | cholecystokinin 33
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖View more information in the IUPHAR Pharmacology Education Project: cck-33 |
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF | |
| Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Ile-Val-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2 | |
| Post-translational Modification | |
| The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H). | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel