Abbreviated name: ELA
Synonyms: ELABELA | Ende | tdl | toddler
Compound class:
Endogenous peptide in human, mouse or rat
Comment: ELA signals via the apelin receptor to mediate endoderm differentiation and embryonic heart morphogenesis, and is present prior to the expression of apelin, making this the earliest ligand recognised by the apelin receptor [1]. More recently (Apr 2017) the activity as an endogenous agonist of the Apelin APJ receptor in the adult cardiovascular system was demonstracted [3].
Species: Human
![]() Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence ![]() |
|
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP | |
Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro |
Post-translational Modification | |
N-linked glycosylation at Asn5 in the peptide sequence shown here (equivalent to Asn27 in the 54 amino acid precursor). |