Abbreviated name: TNFSF1
Synonyms: LTα | TNFβ
Compound class:
Endogenous peptide in human, mouse or rat
Comment: LTA (TNFβ) is a pro-inflammarory cytokine mediating a large variety of inflammatory, immunostimulatory, and antiviral responses. LTA is required during embryonic development of lymphoid organs.
Species: Human
|
Is a component of |
lymphotoxin β2α1 heterotrimer |
Peptide Sequence ![]() |
|
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVV FSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLS PSTVFFGAFAL |
Selected 3D Structures | ||
|
Post-translational Modification | |
Partial O-linked glycosylation of threonine residue at position 7; N-linked glycosylation of asparagine at position 62 |