GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

follistatin   Click here for help

GtoPdb Ligand ID: 4933

Abbreviated name: FS
Synonyms: activin-binding protein
Species: Human
Peptide Sequence Click here for help
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMN
KKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYC
VTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSL
CDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Selected 3D Structures
PDB Id: 2b0u
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 95 and 259, Disulphide bond formation between cysteine resdiues at positions 3 and 26, 13 and 59, 27 and 62, 66 and 77, 71 and 87, 89 and 121, 93 and 114, 103 and 135, 163 and 196, 167 and 189, 278 and 210, 241 and 273, 245 and 266, and 255 and 287