From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

chorionic gonadotropin beta subunit   Click here for help

GtoPdb Ligand ID: 4396

Synonyms: CG-beta | choriogonadotropin subunit beta | chorionic gonadotrophin chain beta
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Is a component of
hCG
Peptide Sequence Click here for help
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVV
SYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Ser-Lys-Glu-Pro-Leu-Arg-Pro-Arg-Cys-Arg-Pro-Ile-Asn-Ala-Thr-Leu-Ala-Val-Glu-Lys-Glu-Gly-Cys-Pro-Val-Cys-Ile-Thr-Val-Asn-Thr-Thr-Ile-Cys-Ala-Gly-Tyr-Cys-Pro-Thr-Met-Thr-Arg-Val-Leu-Gln-Gly-Val-Leu-Pro-Ala-Leu-Pro-Gln-Val-Val-Cys-Asn-Tyr-Arg-Asp-Val-Arg-Phe-Glu-Ser-Ile-Arg-Leu-Pro-Gly-Cys-Pro-Arg-Gly-Val-Asn-Pro-Val-Val-Ser-Tyr-Ala-Val-Ala-Leu-Ser-Cys-Gln-Cys-Ala-Leu-Cys-Arg-Arg-Ser-Thr-Thr-Asp-Cys-Gly-Gly-Pro-Lys-Asp-His-Pro-Leu-Thr-Cys-Asp-Asp-Pro-Arg-Phe-Gln-Asp-Ser-Ser-Ser-Ser-Lys-Ala-Pro-Pro-Pro-Ser-Leu-Pro-Ser-Pro-Ser-Arg-Leu-Pro-Gly-Pro-Ser-Asp-Thr-Pro-Ile-Leu-Pro-Gln
Post-translational Modification
N-linked glycosylation of asparagine residues at postions 13, 30, 121, 127, 132 and 138. Disulfide bons are formed between cysteine residues at positions 9 and 57; 23 and 72; 26 and 110; 34 and 88; 38 and 90 and 93 and 100. The choriogonadotropin beta subunit assembles with the common glycoprotein hormone alpha subunit to form the active hCG heterodimer