GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ErgTx-1   Click here for help

GtoPdb Ligand ID: 2612

Synonyms: CnErg1 | CnErgTx1 | ergtoxin | ergtoxin-like protein 1 | ErgTx | ErgTx1 | potassium channel toxin gamma-KTx 1.1
Compound class: Peptide
Comment: From the venom of Centruroides noxius (Mexican scorpion)
Click here for help
Peptide Sequence Click here for help
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala
Post-translational Modification
Disulphide bonds between cysteine residues at positions 5 and 23, 11 and 34, 20 and 39, and 24 and 41.