ErgTx-1   Click here for help

GtoPdb Ligand ID: 2612

Synonyms: CnErg1 | CnErgTx1 | ergtoxin | ergtoxin-like protein 1 | ErgTx | ErgTx1 | potassium channel toxin gamma-KTx 1.1
Compound class: Peptide or derivative
Comment: From the venom of Centruroides noxius (Mexican scorpion)
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala
Post-translational Modification
Disulphide bonds between cysteine residues at positions 5 and 23, 11 and 34, 20 and 39, and 24 and 41.