From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

efineptakin alfa   Click here for help

GtoPdb Ligand ID: 11097

Synonyms: GX-I7 | Hyleukin-7 | Il-7 hybrid Fc | NT-I7 | rhIL-7-hyFc | TJ-107
Immunopharmacology Ligand
Compound class: Peptide
Comment: Efineptakin alfa is a long-acting immunoglobulin (Ig) fusion protein composed of recombinant human IL-7 fused to a hybrid Fc (hyFc) region of a human antibody. It comprises two disulphide bond-linked peptide chains. Efineptakin alfa has hematopoietic and immunopotentiating activities. In the oncology setting IL-7 enhances T-cell-mediated anti-tumour immune responses. Efineptakin alfa is being developed by Genexine (in-licensed to I-MAB Biopharma) and NeoImmuneTech. The peptide sequence of efineptakin alfa is claimed in Genexine's patent WO2016200219A1 as sequence 24 and would appear to be referred to as MGM-IL-7-hyFc therein [3].
Peptide Sequence Click here for help
MGMDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDL
HLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHRNTGR
GGEEKKKEKEKEEQEERETKTPECPSHTQPLGVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNA
KTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Post-translational Modification
Intra-chain disulphide bridges: 5-95, 37-132, 50-144, 214-274, 320-378 and identical in chain 2 (5'-95', 37'-132', 50'-144', 214'-274', 320'-378')
Inter-chain disulphide bond: 184-184'
N-linked glycosylation sites: Asn-73, Asn-94, Asn-250
O-linked glycosylation site: Thr-113