efineptakin alfa   Click here for help

GtoPdb Ligand ID: 11097

Synonyms: GX-I7 | Hyleukin-7 | Il-7 hybrid Fc | NT-I7 | rhIL-7-hyFc | TJ-107
Immunopharmacology Ligand
Compound class: Peptide or derivative
Comment: Efineptakin alfa is a long-acting immunoglobulin (Ig) fusion protein composed of recombinant human IL-7 fused to a hybrid Fc (hyFc) region of a human antibody. It comprises two disulphide bond-linked peptide chains. Efineptakin alfa has hematopoietic and immunopotentiating activities. In the oncology setting IL-7 enhances T-cell-mediated anti-tumour immune responses. Efineptakin alfa is being developed by Genexine (in-licensed to I-MAB Biopharma) and NeoImmuneTech. The peptide sequence of efineptakin alfa is claimed in Genexine's patent WO2016200219A1 as sequence 24 and would appear to be referred to as MGM-IL-7-hyFc therein [3].
Peptide Sequence Click here for help
MGMDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDL
HLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHRNTGR
GGEEKKKEKEKEEQEERETKTPECPSHTQPLGVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNA
KTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Post-translational Modification
Intra-chain disulphide bridges: 5-95, 37-132, 50-144, 214-274, 320-378 and identical in chain 2 (5'-95', 37'-132', 50'-144', 214'-274', 320'-378')
Inter-chain disulphide bond: 184-184'
N-linked glycosylation sites: Asn-73, Asn-94, Asn-250
O-linked glycosylation site: Thr-113