Synonyms: BMN 111 | BMN-111 | Voxzogo®
vosoritide is an approved drug (EMA & FDA (2021))
Compound class:
Peptide
Comment: Vosoritide is a cyclic analogue of C-type natriuretic peptide (CNP) that has a longer half-life (duration of action) than the endogenous peptide [1]. It comprises the 37 C-terminal amino acids from human CNP with the addition of proline and glycine (PG) at its N-terminal.
Vosoritide represents a novel mechanism which has the potential to treat mutant fibroblast growth factor receptor 3-driven achondroplasia, by stimulating endochondral ossification and thereby ameliorating impaired bone growth [1-3]. |
Peptide Sequence | |
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC | |
Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys |
HELM Notation | |
PEPTIDE1{P.G.Q.E.H.P.N.A.R.K.Y.K.G.A.N.K.K.G.L.S.K.G.C.F.G.L.K.L.D.R.I.G.S.M.S.G.L.G.C}$PEPTIDE1,PEPTIDE1,23:R3-39:R3$$$ |
Chemical Modification | |
Disulphide bridge between residues 23 and 39. |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel