Met-Ckβ7   Click here for help

GtoPdb Ligand ID: 788

Synonyms: Ckβ7 | Met-chemokine β 7
Compound class: Peptide or derivative
Comment: Synthetic analogue of human CCL18. This synthetic peptide has an amino acid substitution at the N-terminus. The reference states that a C-terminally-extended variant produced as a result of a frameshift mutation (ending in LKLMPEA) showed identical antagonist activity to the structure shown here
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
MQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Met-Gln-Val-Gly-Thr-Asn-Lys-Glu-Leu-Cys-Cys-Leu-Val-Tyr-Thr-Ser-Trp-Gln-Ile-Pro-Gln-Lys-Phe-Ile-Val-Asp-Tyr-Ser-Glu-Thr-Ser-Pro-Gln-Cys-Pro-Lys-Pro-Gly-Val-Ile-Leu-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Ile-Cys-Ala-Asp-Pro-Asn-Lys-Lys-Trp-Val-Gln-Lys-Tyr-Ile-Ser-Asp-Leu-Lys-Leu-Asn-Ala
Chemical Modification
N-terminal alanine residue of the natural sequence of CCL18 is replaced with methionine