Synonyms: HOE-901 | HOE901 | Lantus®
insulin glargine is an approved drug (FDA and EMA (2000))
Compound class:
Peptide or derivative
Comment: Insulin glargine is a recombinant, modified analogue of human insulin. The chemical structure shown here was generated using the SMILES from PubChem CID 44146714.
A number of insulin glargine biosimilars have been approved internationally since the expiration of patents on Lantus® in 2014: a comprehensive list that is maintained by the Generics and Biosimilar Initiative (https://www.gabionline.net) is available here. The first fully interchangeable biosimilar to be FDA approved was Semglee® (insulin glargine-yfgn; Mylan Pharmaceuticals), in July 2021. View more information in the IUPHAR Pharmacology Education Project: glargine |
Peptide Sequence | |
H-Phe-Val-Asn-Gln-His-Leu-Cys(1)-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys (2)-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg-OH.H-Gly-Ile-Val-Glu-Gln -Cys(3)-Cys(1)-Thr-Ser-Ile-Cys(3)-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys(2)-Gly-OH |
|
H-FVNQHLC(1)GSHLVEALYLVC(2)GERGFFYTPKTRR-OH.H-GIVEQC(3)C(1)TSIC(3)SLYQLENYC(2)G-OH |
HELM Notation | |
PEPTIDE1{F.V.N.Q.H.L.C.G.S.H.L.V.E.A.L.Y.L.V.C.G.E.R.G.F.F.Y.T.P.K.T.R.R}|PEPTIDE2{G.I.V.E.Q.C.C.T.S.I.C.S.L.Y.Q.L.E.N.Y.C.G}$PEPTIDE1,PEPTIDE2,7:R3-7:R3|PEPTIDE2,PEPTIDE2,6:R3-11:R3|PEPTIDE1,PEPTIDE2,19:R3-20:R3$$$ |
Chemical Modification | |
The A chain has peptide sequence GIVEQCCTSICSLYQLENYCG, where the C terminal glycine replaces the natural asparagine. The B chain has the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR which has two additional C-terminal arginine residues compared to endogenous insulin. Disulphide bond formation is equivalent to that observed in the endogenous active hormone dimer. |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
Molecular structure representations generated using Open Babel