[125I][Nle75,Tyr77]apelin-36 (human)

Ligand id: 603

Name: [125I][Nle75,Tyr77]apelin-36 (human)    

Peptide Sequence
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPXPY
Leu-Val-Gln-Pro-Arg-Gly-Pro-Arg-Ser-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Nle-Pro-Tyr
Chemical Modification
Methioine residue at position 75 of the natural sequence is replaced by norleucine; C-terminal phenylalanine is replaced by tyrosine