GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I][Nle75,Tyr77]apelin-36 (human)   Click here for help

GtoPdb Ligand ID: 603

 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPXPY
Leu-Val-Gln-Pro-Arg-Gly-Pro-Arg-Ser-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Nle-Pro-Tyr
Chemical Modification
Methioine residue at position 75 of the natural sequence is replaced by norleucine; C-terminal phenylalanine is replaced by tyrosine