GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

T20(DP178)   Click here for help

GtoPdb Ligand ID: 5838

Synonyms: T20(DP178) [HIV-1 gp41 derived peptide]
Compound class: Peptide
Comment: A HIV-1 gp41 derived peptide. The sequence of this peptide corresponds to the C-terminus of the ectodomain of gp41.
Click here for help
Peptide Sequence Click here for help
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2
Chemical Modification
N-terminal tyrosine residue is acetylated; C-terminal phenylalanine residue is phenylalanine-amide.