GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

muscarinic toxin 7   Click here for help

GtoPdb Ligand ID: 314

Synonyms: m1-toxin 1 | MT7 | recombinant mamba venom toxin | rMT7 [3]
Compound class: Peptide
Comment: Recombinant MT7 (rMT7) is often used for bioassays due to the limited availability of the M1 muscarinic receptor-selective mamba toxin MT7 [1] or m1-toxin 1 (rMT7 has comparable affinity for M1 [3])
Click here for help
Peptide Sequence Click here for help
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK
Leu-Thr-Cys-Val-Lys-Ser-Asn-Ser-Ile-Trp-Phe-Pro-Thr-Ser-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-Gln-Tyr-Ile-Ser-Pro-Arg-Met-Tyr-Asp-Phe-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Lys-Ala-Glu-Tyr-Arg-Asp-Val-Ile-Asn-Cys-Cys-Gly-Thr-Asp-Lys-Cys-Asn-Lys
Selected 3D Structures
PDB Id: 3FEV
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 3-24, 17 and 42, 46 and 57 and 58 and 63