GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

OSK1-K16-D20   Click here for help

GtoPdb Ligand ID: 2556

Synonyms: [K16,D20]-OSK1
Compound class: Peptide
Comment: A synthetic analogue of the toxin OSK1 from the Central asian scorpion (Orthochirus scrobiculosus)
Click here for help
Peptide Sequence Click here for help
GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK
Gly-Val-Ile-Ile-Asn-Val-Lys-Cys-Lys-Ile-Ser-Arg-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys
Chemical Modification
Synthetic analogue of OSK1. The glutamic acid residue at position 16 is substituted by lysine and the lysine at position 20 is substituted by an aspartic acid