GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

pandinotoxin-K α   Click here for help

GtoPdb Ligand ID: 2553

Synonyms: potassium channel toxin α-KTx 7.1 | potassium channel-blocking toxin 2 | toxin PiTX-K-α
Compound class: Peptide
Comment: From Pandinus imperator (Emperor scorpion)
Click here for help
Peptide Sequence Click here for help
TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR
Thr-Ile-Ser-Cys-Thr-Asn-Pro-Lys-Gln-Cys-Tyr-Pro-His-Cys-Lys-Lys-Glu-Thr-Gly-Tyr-Pro-Asn-Ala-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Phe-Gly-Arg
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 25, 10 and 30, and 14 and 32