GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

hongotoxin-1   Click here for help

GtoPdb Ligand ID: 2545

Synonyms: HgTX1 | potassium channel toxin α-KTx 2.5
Compound class: Peptide
Comment: From Centruroides limbatus (Bark scorpion)
Click here for help
Peptide Sequence Click here for help
TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH
Thr-Val-Ile-Asp-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Ile-Arg-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 29, 13 and 34, and 17 and 36.