GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

dendrotoxin-I   Click here for help

GtoPdb Ligand ID: 2544

Synonyms: dendrotoxin | dendrotoxin I | venom basic protease inhibitor 1
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 57, 16 and 40, and 32 and 53