charybdotoxin-GLU32 analog   Click here for help

GtoPdb Ligand ID: 2329

Synonyms: ChTX-GLU32
Compound class: Peptide
Comment: An analogue of the yellow scorpion toxin charybdotoxin
Click here for help
Peptide Sequence Click here for help
QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS
pGlu-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Glu-Cys-Arg-Cys-Tyr-Ser
Chemical Modification
C-terminal glutamine is pyrrolidone carboxylic acid; disulphide bond formation between cysteine residues at positions 7 and 28, 13 and 33, and 17 and 35. Lysine residue at position 32 of charybdotoxin is substituted by glutamic acid