toxin BmP09   Click here for help

GtoPdb Ligand ID: 2306

Synonyms: B. martensi Karsch toxin | beta-toxin BmKAs1 | BmK activator of skeletal-muscle ryanodine receptor
Compound class: Peptide or derivative
Comment: From the venom of Buthus martensii
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
DNGYLLNKYTGCKIWCVINNESCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYETNKCNGKM
Asp-Asn-Gly-Tyr-Leu-Leu-Asn-Lys-Tyr-Thr-Gly-Cys-Lys-Ile-Trp-Cys-Val-Ile-Asn-Asn-Glu-Ser-Cys-Asn-Ser-Glu-Cys-Lys-Leu-Arg-Arg-Gly-Asn-Tyr-Gly-Tyr-Cys-Tyr-Phe-Trp-Lys-Leu-Ala-Cys-Tyr-Cys-Glu-Gly-Ala-Pro-Lys-Ser-Glu-Leu-Trp-Ala-Tyr-Glu-Thr-Asn-Lys-Cys-Asn-Gly-Lys-Met
Post-translational Modification
Disulphide bonds between cysteine residues at positions 12 and 62, 16 and 37, 23 and 44, and 27 and 46