GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[PP1-17,Ala31,Aib32]NPY (human)   Click here for help

GtoPdb Ligand ID: 1561

Compound class: Peptide
Comment: Synthetic analogue of human neuropeptide Y
Click here for help
Peptide Sequence Click here for help
APLEPVYPGDNATPEQMARYYSALRHYINLAXRQRY
Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ala-Aib-Arg-Gln-Arg-Tyr-NH2
Chemical Modification
Isoleucine at position 31 of the natural NPY sequence and threonine at position 32 are replaced by alanine and α-aminoisobutyric acid respectively. The first 17 residues in the amino acid sequence for NPY are replaced by thre first 17 residues from human PP