GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[D-Trp32]NPY   Click here for help

GtoPdb Ligand ID: 1544

Synonyms: [D-Trp32] neuropeptide Y | [D-Trp32]-NPY
Compound class: Peptide
Comment: Synthetic analogue of neuropeptide Y
Click here for help
Peptide Sequence Click here for help
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-D-Tyr-NH2
Chemical Modification
Tyrosine residue at position 32 is replaced by the D-isomer