bulevirtide 
GtoPdb Ligand ID: 12775
|
Synonyms: BLV | formerly Myrcludex B | Hepcludex®
bulevirtide is an approved drug (EMA (2020), UK HMRA (2021))
Compound class:
Peptide or derivative
Comment: Bulevirtide is a lipopeptide antiviral agent. It blocks entry of the hepatitis-causing viruses HBV and HDV into hepatocytes [1]. The peptide structure of bulevirtide is derived from the pre-S1 domain of the large envelope protein of HBV surface antigen (HBsAg) [4], that binds to the heoatocyte expressed surface protein sodium/bile acid and sulphated solute cotransporter 1 (NTCP; SLC10A1) to mediate viral entry into host cells. Bulevirtide functionally blocks this entry process [3].
|
Peptide Sequence  |
|
| C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2 | |
|
CH |
|
This work is licensed under a Creative Commons Attribution-ShareAlike 4.0 International License