growth differentiation factor 15   Click here for help

GtoPdb Ligand ID: 9735

Abbreviated name: GDF15
Synonyms: macrophage inhibitory cytokine-1 | MIC-1 | MIC1 | PTGFB
Comment: GDF15 is a TGFβ family protein. A commentary on the function(s) of GDF15 was published in 2017 [8]. Experimental evidence indicates that the biological effects of GDF15 are mediated by signalling via a GFRAL/Ret complex [4,7-8,10].
GDF15 promotes nausea and vomiting (emesis), and elevated levels have been associated with pregnancy-induced morning sickness and the risk of hyperemesis gravidarum [5]. Disrupting the formation or function of the GDF15/GFRAL/Ret complex is a mechanism being explored for the mitigation of chemotherapy-induced nausea, cachexia and malaise [1,6,9]. GDF15/GFRAL signalling is also a major driver of nausea, elevated catabolism and weight loss in patients with advanced cancer [2-3].
Species: Human
Click here for help
Peptide Sequence Click here for help
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDL
VPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLS
PPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Post-translational Modification
Signal peptide: 1-29
Propeptide 30-194
Mature peptide chain 195-308
Three intrapeptide disulphide bonds, and one interpeptide (dimer forming) disulphide bond.