GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

liver enriched antimicrobial peptide 2   Click here for help

GtoPdb Ligand ID: 9734

Abbreviated name: LEAP2
Immunopharmacology Ligand
Comment: LEAP2 is an endogenous peptide with antimicrobial properties, that is part of the humoral immune response to microbes. It is expressed in the liver. LEAP2 has also been identified as an endogenous antagonist of the appetite-stimulatory hormone, ghrelin, that is secreted in the stomach and which acts via the pituitary/hypothalamic ghrelin receptor (growth hormone secretagogue receptor, or GHSR) [1].
Species: Human
Click here for help
Peptide Sequence Click here for help
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Post-translational Modification
Residues 1-22 are a signal peptide, and residues 23-37 is cleaved leaving amino acids 38-77 to form the mature peptide. Two disulphide bonds between Cys54and Cys65 and Cys60 and Cys70.