GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

urocortin 3   Click here for help

GtoPdb Ligand ID: 929

Comment: The mouse Ucn3 sequence is identical to the rat Ucn3 sequence.
Species: Mouse, Rat
Click here for help
Peptide Sequence Click here for help
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Post-translational Modification
The C-terminal isoleucine is amidated.