From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CXCL9   Click here for help

GtoPdb Ligand ID: 837

Synonyms: MIG | monokine induced by gamma-interferon
Immunopharmacology Ligand
Comment: CXCL9 is a chemokine. It acts as a chemoattractant for activated T cells and tumour-infiltrating leukocytes, but not for neutrophils or monocytes.
Species: Human
Click here for help
Peptide Sequence Click here for help
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNG
KKHQKKKVLKVRKSQRSRQKKTT
Thr-Pro-Val-Val-Arg-Lys-Gly-Arg-Cys-Ser-Cys-Ile-Ser-Thr-Asn-Gln-Gly-Thr-Ile-His-Leu-Gln-Ser-Leu-Lys-Asp-Leu-Lys-Gln-Phe-Ala-Pro-Ser-Pro-Ser-Cys-Glu-Lys-Ile-Glu-Ile-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Val-Gln-Thr-Cys-Leu-Asn-Pro-Asp-Ser-Ala-Asp-Val-Lys-Glu-Leu-Ile-Lys-Lys-Trp-Glu-Lys-Gln-Val-Ser-Gln-Lys-Lys-Lys-Gln-Lys-Asn-Gly-Lys-Lys-His-Gln-Lys-Lys-Lys-Val-Leu-Lys-Val-Arg-Lys-Ser-Gln-Arg-Ser-Arg-Gln-Lys-Lys-Thr-Thr