From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CXCL11   Click here for help

GtoPdb Ligand ID: 836

Synonyms: IP9 | ITAC
Immunopharmacology Ligand
Comment: CXCL11 is a C-X-C motif chemokine. It exerts its biological effects via interaction with the CXCR3 GPCR.
Species: Human
Click here for help
Peptide Sequence Click here for help
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Phe-Pro-Met-Phe-Lys-Arg-Gly-Arg-Cys-Leu-Cys-Ile-Gly-Pro-Gly-Val-Lys-Ala-Val-Lys-Val-Ala-Asp-Ile-Glu-Lys-Ala-Ser-Ile-Met-Tyr-Pro-Ser-Asn-Asn-Cys-Asp-Lys-Ile-Glu-Val-Ile-Ile-Thr-Leu-Lys-Glu-Asn-Lys-Gly-Gln-Arg-Cys-Leu-Asn-Pro-Lys-Ser-Lys-Gln-Ala-Arg-Leu-Ile-Ile-Lys-Lys-Val-Glu-Arg-Lys-Asn-Phe