From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

C5a   Click here for help

GtoPdb Ligand ID: 573

Synonyms: C5a anaphylatoxin | complement component C5a | human complement protein
Immunopharmacology Ligand
Comment: C5a is the ligand for the GPCR, C5a receptor (CD88) that is expressed by macrophages, neutrophils and endothelial cells. C5a is a potent inflammatory agent that is a key mediator involved in the pathogenesis of a number of inflammatory diseases involving the complement system (sepsis, rheumatoid arthritis, inflammatory bowel disease, systemic lupus erythemotosis and psoriasis for example).
Species: Human
Click here for help
Peptide Sequence Click here for help
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg