GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TIMP4   Click here for help

GtoPdb Ligand ID: 5312

Synonyms: TIMP-4
Species: Human
Peptide Sequence Click here for help
CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEAN
SQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYG
YQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 93, 3 and 102, 13 and 127, 129 and 176, 134 and 139, and 147 and 168.