GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TIMP3   Click here for help

GtoPdb Ligand ID: 5311

Synonyms: MIG-5
Species: Human
Peptide Sequence Click here for help
CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYL
LTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYA
CIRQKGGYCSWYRGWAPPDKSIINATDP
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 1 and 68, 3 and 95, and 13 and 120. Predicted disulphide bond formation between cysteine residues at positions 122 and 169, 127 and 132, and 140 and 161.