FLICE-like inhibitory protein subunit p12   Click here for help

GtoPdb Ligand ID: 5187

Abbreviated name: FLIP subunit p12
Synonyms: CASP8 and FADD-like apoptosis regulator subunit p12
Compound class: Endogenous peptide in human, mouse or rat
Comment: This is the short isoform of cFLIP (c-FLIPS). It is acts as a death receptor inhibitor, by antagonising procaspase-8 incorporation into the death-inducing signaling complex (DISC), and has modulatory actions on the immune system (upregulated by T cell receptor activation).
Species: Human
Is a component of
FLICE-like inhibitory protein
Peptide Sequence Click here for help
GPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSR
VSAKEKYYVWLQHTLRKKLILSYT