From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

BH3 interacting-domain death agonist   Click here for help

GtoPdb Ligand ID: 5152

Abbreviated name: BID
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQE
DIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVA
SHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Post-translational Modification
Tyrosine residue at position 54 is phosphotyrosine; serine residue at position 78 is phosphoserine