GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CD30 ligand   Click here for help

GtoPdb Ligand ID: 5080

Synonyms: 
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGG
NCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKL
ELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Selected 3D Structures
PDB Id: 1D01
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-liked glycosylation of asparagine residues at positions 81, 109, 153, 189 and 201. Predicted disulphide bond formation between cysteine residues at positions 151 and 177