From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

BAFF   Click here for help

GtoPdb Ligand ID: 5069

Synonyms: B cell-activating factor | CD257 antigen | dendritic cell-derived TNF-like molecule
Immunopharmacology Ligand
Comment: The TNFSF13B precursor is also cleaved into a soluble form of the ligand.
Species: Human
Peptide Sequence Click here for help
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLR
AELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQK
GSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Selected 3D Structures
PDB Id: 1jh5
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residues at positions 124 and 242 (high mannose at 242); disulphide bond formation between cysteine residues at positions 232 and 245