GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: A proliferation-inducing ligand | TALL2 | TNF- and APOL-related leukocyte expressed ligand 2 | TNF-related death ligand 1 | TRDL-1 | ZTNF2
Compound class:
Endogenous peptide in human, mouse or rat
Comment: APRIL (also known as tumor necrosis factor ligand superfamily member 13; TNFSF13) is a protein of the TNF superfamily recognized by the cell surface catalytic receptor TACI [9] and other TNF family receptors [3]. Three APRIL isoforms have bee reported [1]. We provide the amino acid sequence for the mature peptide chain (i.e. without the 104 amino acid propeptide leader sequence which is cleaved by furin convertase in the Golgi apparatus prior to secretion [4]).
Species: Human
|
Peptide Sequence ![]() |
|
|
AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSR EGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residue at position 20; predicted disulphide bond formation between cysteine residues at positions 92 and 107 | |