GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

insulin B chain   Click here for help

GtoPdb Ligand ID: 5014

Compound class: Endogenous peptide in human, mouse or rat
Comment: The B chain is 30 amino acids long, and relates to amino acids 25-54 of the pro-peptide sequence (P01308).
Species: Human
Is a component of
insulin
Peptide Sequence Click here for help
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr
Post-translational Modification
Two inter-chain disulphide bonds form with the insulin A chain to form the active peptide, between cysteine residues 7 of the B chain and 7 of the A chain, and 20 of the B chain and 19 of the A chain (numbering relative to the amino acid sequences of the individual peptide chains).