GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

insulin-like growth factor 2   Click here for help

GtoPdb Ligand ID: 4972

Abbreviated name: IGF2
Synonyms: insulin-like growth factor II | somatomedin-A
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Selected 3D Structures
PDB Id: 1igl
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 9 and 47, 21 and 60, and 46 and 51