GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α14   Click here for help

GtoPdb Ligand ID: 4957

Synonyms: IFN alpha-14 | interferon alpha-14 | interferon alpha-H | interferon lambda-2-H
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-α14 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDET
LLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQK
RLRRKD
Post-translational Modification
N-linked glycosylation of asparagine residue at position 63; predicted disulphide bonds between cysteine residues at positions 1 and 99, and 29 and 39