Peptide Sequence

AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCI PTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG

Post-translational Modification

The active peptide is predicted to be either a homodimer or a heterodimer, which cannot be disulphide linked. Predicted N-linked glycosylation of asparagine residue at position 56; predicted disulphide bond formation between cysteine residues at positions 14 and 79, 43 and 111, and 47 and 113