GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

growth/differentiation factor-1   Click here for help

GtoPdb Ligand ID: 4936

Abbreviated name: GDF1
Synonyms: embryonic growth/differentiation factor 1 | GDF-1
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
DAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGGPPALNHAVLRALMHAAAPGAAD
LPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECGCR
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 83 of each chain. Disulphide bond formation between cysteine residues at positions 14 and 84, 43 and 116, and 47 and 118