GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-8   Click here for help

GtoPdb Ligand ID: 4929

Synonyms: androgen-induced growth factor (AIGF) | heparin-binding growth factor 8 (HBGF-8)
Comment: Monomer and homodimer
Species: Human
Peptide Sequence Click here for help
QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFA
KLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSK
TRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Selected 3D Structures
PDB Id: 2fdb
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 133