GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-A1   Click here for help

GtoPdb Ligand ID: 4908

Abbreviated name: EFNA1
Synonyms: EPH-related receptor tyrosine kinase ligand 1 | immediate early response protein B61 | TNF alpha-induced protein 4 | tumor necrosis factor alpha-induced protein 4 (TNFAIP4)
Compound class: Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins. Momomer and homodimer
Species: Human
Peptide Sequence Click here for help
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAK
HGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHS
IGHS
Selected 3D Structures
PDB Id: 3CZU
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 33 and 74, and 62 and 122. Predicted amidation of C-terminal serine residue; predicted N-linked glycosylation of asparagine at position 8