Abbreviated name: EFNA1
Synonyms: EPH-related receptor tyrosine kinase ligand 1 | immediate early response protein B61 | TNF alpha-induced protein 4 | tumor necrosis factor alpha-induced protein 4 (TNFAIP4)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins. Momomer and homodimer
Species: Human
|
Peptide Sequence ![]() |
|
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAK HGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHS IGHS |
Selected 3D Structures | ||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 33 and 74, and 62 and 122. Predicted amidation of C-terminal serine residue; predicted N-linked glycosylation of asparagine at position 8 |