brain natriuretic peptide   Click here for help

GtoPdb Ligand ID: 4890

Abbreviated name: BNP
Synonyms: BNP(1-32) | BNP-32 | brain natriuretic peptide 32 | Natrecor®
Approved drug
brain natriuretic peptide is an approved drug (FDA (2001))
Compound class: Endogenous peptide in human, mouse or rat
Comment: Nesiritide is the recombinant form of human brain natriuretic peptide.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: brain natriuretic peptide

Peptide Sequence Click here for help
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His
Selected 3D Structures
PDB Id: 3N56
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 1 and 112