Synonyms: colorectal cell-derived growth factor (CRDGF)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Amphiregulin is an epidermal growth factor family member that is involved in tissue repair.
Species: Human
|
Peptide Sequence ![]() |
|
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEK |
Selected 3D Structures | ||
|
Post-translational Modification | |
N-linked glycosylation of asparagine residue at position 19; predicted N-linked glycosylation of asparagine at position 113. Predicted disulphide bond formation between cysteine resdiues at positions 46 and 59, 54 and 70, and 72 and 81 |