GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

protein C heavy chain   Click here for help

GtoPdb Ligand ID: 4475

Species: Human
Is a component of
Peptide Sequence Click here for help
DTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELD
LDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFV
LNFIKIPVVPHNECSEVMSNMSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSR
YLDWIHGHIRDKEAPQKSWAP
Post-translational Modification
N-linked glycosylation of asparagine residues at positions 90, 155 and 171. Disulphide bonds between cysteine residues at positions 38 and 54, 173 and 187 and 198 and 226.

Protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 120 of the heavy chain