GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Is a component of |
protein C |
Peptide Sequence ![]() |
|
ANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDC RSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL |
Post-translational Modification | |
Carboxylation of glutamate residues at positions 6, 7, 14, 16, 19, 20, 25, 26, 29, 71 and 97. Disulphide bonds between cysteine residues at positions 17 and 22, 50 and 69, 59 and 64, 63 and 78, 80 and 89, 98 and 109, 105 and 118, and 140 and 133. N-linked glycosylation of asparagine residue at position 97. Protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 120 of the heavy chain |