From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

kisspeptin-52   Click here for help

GtoPdb Ligand ID: 3710

Synonyms: KP-52
Compound class: Endogenous peptide in human, mouse or rat
Species: Rat
Peptide Sequence Click here for help
TSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRY
Thr-Ser-Pro-Cys-Pro-Pro-Val-Glu-Asn-Pro-Thr-Gly-His-Gln-Arg-Pro-Pro-Cys-Ala-Thr-Arg-Ser-Arg-Leu-Ile-Pro-Ala-Pro-Arg-Gly-Ser-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Met-Ser-Ala-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.