GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

R-spondin-4   Click here for help

GtoPdb Ligand ID: 3700

Synonyms: hRspo4 | roof plate-specific spondin-4
Species: Human
Click here for help
Peptide Sequence Click here for help
LNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRREGIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCF
SQDFCIRCKRQFYLYKGKCLPTCPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAA
TCQVLSESRKCPIQRPCPGERSPGQKKGRKDRRPRKDRKLDRRLDVRPRQPGLQP
Post-translational Modification
Phosphorylation of tyrosine residue at position 93; asparagine residue at position 15 is N-linked glycosylated; disulfide bonds between cysteine residues at positions 120 and 162; 131 and 138; 171 and 177